PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G2291
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 225aa    MW: 26344.8 Da    PI: 6.1685
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G2291genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.11e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+ +++  g+ R++k+c++rw +yl
      Gh_D07G2291 14 RGPWTIEEDHKLMNFIFNNGIPCWRHVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding54.62.5e-1767110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T+ E++ +++++ qlG++ W++Ia++++ gRt++++k++w++
      Gh_D07G2291  67 RGCFTESEEDEIIRLHLQLGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-21564IPR009057Homeodomain-like
PROSITE profilePS5129413.761961IPR017930Myb domain
SuperFamilySSF466891.84E-2711108IPR009057Homeodomain-like
SMARTSM007178.3E-71363IPR001005SANT/Myb domain
PfamPF002491.1E-111461IPR001005SANT/Myb domain
CDDcd001678.28E-51661No hitNo description
PROSITE profilePS5129426.26562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2565117IPR009057Homeodomain-like
SMARTSM007171.0E-1566114IPR001005SANT/Myb domain
PfamPF002491.8E-1567110IPR001005SANT/Myb domain
CDDcd001679.15E-1170110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRKPCCDKV GLKRGPWTIE EDHKLMNFIF NNGIPCWRHV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGCF TESEEDEIIR LHLQLGNRWS KIASHFPGRT DNEIKNHWNT RIRKKLKLLG  120
LDPVTHKPIE NGEKNKQEET KSEDVRKDDE IQTTLDGTET DDLLNNYEIL CGSLDSSFSK  180
EESNNPSMAT QEEDCLKQWV DCVDSFFSWD NFTHLEEQIP FPPWL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445351.11e-165PREDICTED: myb-related protein 315-like
SwissprotP813941e-74MYB15_ANTMA; Myb-related protein 315
TrEMBLA0A0D2QWG61e-165A0A0D2QWG6_G
STRINGPOPTR_0001s36220.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.19e-82myb domain protein 40